S100Z Rabbit Polyclonal Antibody

SKU TA330302

Rabbit Polyclonal Anti-S100Z Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-S100Z antibody is: synthetic peptide directed towards the N-terminal region of Human S100Z. Synthetic peptide located within the following region: MPTQLEMAMDTMIRIFHRYSGKERKRFKLSKGELKLLLQRELTEFLSCQK
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 10 kDa
• Gene Name: S100 calcium binding protein Z
• Database Link:
  NP_570128
  Q8WXG8
• Background: Members of the S100 protein family contain 2 calcium-binding EF-hands and exhibit cell-type specific expression patterns. For additional background information on S100 proteins, see MIM 114085.
• Synonyms: Gm625; S100-zeta
• Note: Immunogen sequence homology: Human: 100%

Reference Data