NR2F6 Rabbit Polyclonal Antibody

SKU TA330216

Rabbit Polyclonal Anti-NR2F6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NR2F6 antibody: synthetic peptide directed towards the N terminal of human NR2F6. Synthetic peptide located within the following region: MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPPGAASDAEPGDEERP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: nuclear receptor subfamily 2 group F member 6
• Database Link:
  NP_005225
  P10588
• Background: NR2F6 is a nuclear orphan receptor that belongs to the COUP-TF subfamily
• Synonyms: EAR-2; EAR2; ERBAL2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Guinea pig: 93%; Rat: 87%; Mouse: 87%

Reference Data

• Protein Families: Druggable Genome, Nuclear Hormone Receptor, Transcription Factors