NT5C3 (NT5C3A) Rabbit Polyclonal Antibody

CAT#: TA330188

Rabbit Polyclonal Anti-NT5C3 Antibody

Product Images

WB Suggested Anti-NT5C3 Antibody Titration: 0.2-1 ug/ml; Positive Control: HepG2 cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NT5C3 antibody: synthetic peptide directed towards the middle region of human NT5C3. Synthetic peptide located within the following region: VKVVSNFMDFDETGVLKGFKGELIHVFNKHDGALRNTEYFNQLKDNSNII
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: 5'-nucleotidase, cytosolic IIIA
• Database Link:
  NP_057573
  Entrez Gene 51251 Human
  UniProt ID Q9H0P0
• Background: Pyrimidine 5-prime-nucleotidase (P5N), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. Pyrimidine 5-prime-nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1) and type II (UMPH2; MIM 191720). The 2 enzymes are not separable by electrophoresis in humans but have distinct kinetic properties, and the proteins show no homology. [supplied by OMIM]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: cN-III; hUMP1; NT5C3; P5 N-1; P5N-1; p36; PN-I; POMP; PSN1; UMPH; UMPH1
• Note: Immunogen sequence homology: Human: 100%; Dog: 92%; Pig: 92%; Rat: 92%; Horse: 92%; Mouse: 92%; Rabbit: 92%; Zebrafish: 92%; Guinea pig: 92%; Bovine: 85%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism