SLC34A3 Rabbit Polyclonal Antibody

SKU TA330185

Rabbit Polyclonal Anti-SLC34A3 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3. Synthetic peptide located within the following region: LLERLSELALGAASLTPRAQAPDILKVLTKPLTHLIVQLDSDMIMSSATG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: solute carrier family 34 member 3
• Database Link:
  NP_543153
  Q8N130
• Background: SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.
• Synonyms: HHRH; NPTIIc
• Note: Immunogen sequence homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 85%

Reference Data

• Protein Families: Transmembrane