RAX Rabbit Polyclonal Antibody

SKU TA330182

Rabbit Polyclonal Anti-RAX Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-RAX antibody: synthetic peptide directed towards the N terminal of human RAX. Synthetic peptide located within the following region: EYEAPRPYCPKEPWEARPSPGLPVGPATGEAKLSEEEQPKKKHRRNRTTF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: retina and anterior neural fold homeobox
• Database Link:
  NP_038463
  Q9Y2V3
• Background: Retinal Homeobox Protein Rx (RAX) is a member of homeobox family of transcription factors. Mutations mouse and fish RAX lead to defects in retinal development and result in animal models of anophthalmia.
• Synonyms: MCOP3; RX
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Rat: 93%; Pig: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Druggable Genome