NFIC Rabbit Polyclonal Antibody

SKU TA330165

Rabbit Polyclonal Anti-NFIC Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: IHC, WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-NFIC antibody: synthetic peptide directed towards the middle region of human NFIC. Synthetic peptide located within the following region: KSPFNSPSPQDSPRLSSFTQHHRPVIAVHSGIARSPHPSSALHFPTTSIL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 55 kDa
• Gene Name: nuclear factor I C
• Database Link:
  NP_995315
  P08651
• Background: Brg- or hBrm-associated factor (BAF) complexes, a chromatin-remodeling complex family of mammalian cells, facilitate transcriptional activity by remodeling nucleosome structure. Brg1 is the core subunit of Brg-associated factor complexes. BAF complexes can interact with NF1/CTF and RNAP II, and this interaction is closely dependent on the activation of gene transcription.
• Synonyms: CTF; CTF5; NF-I; NFI
• Note: Immunogen sequence homology: Bovine: 100%; Dog: 100%; Guinea pig: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Chicken: 93%; African clawed frog: 86%

Reference Data

• Protein Families: Transcription Factors