ZBTB6 Rabbit Polyclonal Antibody

SKU TA330126

Rabbit Polyclonal Anti-ZBTB6 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZBTB6 antibody: synthetic peptide directed towards the N terminal of human ZBTB6. Synthetic peptide located within the following region: SDPDVKNEDENSDKDCEIIEISEDSPVNIDFHVKEEESNALQSTVESLTS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: zinc finger and BTB domain containing 6
• Database Link:
  NP_006617
  Q15916
• Background: ZBTB6 contains 1 BTB (POZ) domain and 4 C2H2-type zinc fingers. ZBTB6 may be involved in transcriptional regulation.
• Synonyms: ZID; ZNF482
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Bovine: 92%; Horse: 92%; Pig: 92%

Reference Data

• Protein Families: Transcription Factors