TFIIE alpha (GTF2E1) Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GTF2E1 antibody: synthetic peptide directed towards the N terminal of human GTF2E1. Synthetic peptide located within the following region: DHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTGTFRCTFC |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 49 kDa |
Gene Name | general transcription factor IIE subunit 1 |
Database Link | |
Background | GTF2E1 belongs to the TFIIE alpha subunit family. It recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase. |
Synonyms | FE; TF2E1; TFIIE-A |
Note | Immunogen sequence homology: African clawed frog: 100%; Bovine: 100%; Chicken: 100%; Dog: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Mouse: 92%; Rat: 92% |
Reference Data | |
Protein Families | Transcription Factors |
Protein Pathways | Basal transcription factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.