CREB5 Rabbit Polyclonal Antibody

SKU TA330056

Rabbit Polyclonal Anti-CREB5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CREB5 antibody: synthetic peptide directed towards the N terminal of human CREB5. Synthetic peptide located within the following region: CSLEHEFRKAQEEESSKRNISMHNAVGGAMTGPGTHQLSSARLPNHDTNV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 53 kDa
• Gene Name: cAMP responsive element binding protein 5
• Database Link:
  NP_878902
  Q02930
• Background: CREB5 belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. This protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified.
• Synonyms: CRE-BPA; CREB-5
• Note: Immunogen sequence homology: Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Mouse: 92%; Chicken: 85%; Guinea pig: 85%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Huntington's disease, Prostate cancer