ETS1 Rabbit Polyclonal Antibody

SKU
TA330028
Rabbit Polyclonal Anti-ETS1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application IHC, WB
Recommended Dilution WB, IHC
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ETS1 antibody: synthetic peptide directed towards the N terminal of human ETS1. Synthetic peptide located within the following region: TFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMN
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 50 kDa
Gene Name ETS proto-oncogene 1, transcription factor
Database Link
Background ETS-1 is a member of the ets family of transcription factors, which are key mediators of physiological and pathological processes.
Synonyms ETS-1; EWSR2; p54
Note Immunogen sequence homology: Bovine: 100%; Dog: 100%; Goat: 100%; Guinea pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%; Zebrafish: 84%; African clawed frog: 76%
Reference Data
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Dorso-ventral axis formation, Pathways in cancer, Renal cell carcinoma
Write Your Own Review
You're reviewing:ETS1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.