Smarca1 Rabbit Polyclonal Antibody

SKU
TA329969
Rabbit Polyclonal Anti-SMARCA1 Antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB, ChIP
Reactivity Human, Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 43 kDa
Gene Name SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
Database Link
Background cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
Synonyms DKFZp686D1623; FLJ41547; ISWI; NURF140; OTTHUMP00000023983; SNF2L; SNF2L1; SNF2LB; SWI; SWI2
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%
Reference Data
Write Your Own Review
You're reviewing:Smarca1 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.