Smarca1 Rabbit Polyclonal Antibody

SKU TA329969

Rabbit Polyclonal Anti-SMARCA1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB, ChIP
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SMARCA1 antibody: synthetic peptide directed towards the N terminal of mouse SMARCA1. Synthetic peptide located within the following region: VAVSDARATVVVVEDEQPGPSTFKEEGAAAAATEGTTATEKGEKKEKITS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 1
• Database Link:
  NP_444353
  Q6PGB8
• Background: cDNA library was prepared and sequenced in Mouse Genome Encyclopedia Project of Genome Exploration Research Group in Riken Genomic Sciences Center and Genome Science Laboratory in RIKEN.
• Synonyms: DKFZp686D1623; FLJ41547; ISWI; NURF140; OTTHUMP00000023983; SNF2L; SNF2L1; SNF2LB; SWI; SWI2
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%

Reference Data