Jdp2 Rabbit Polyclonal Antibody

CAT#: TA329960

Rabbit Polyclonal Anti-Jundm2 Antibody

Product Images

WB Suggested Anti-Jundm2 Antibody Titration: 0.2-1 ug/ml; Positive Control: Mouse Heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the n terminal of mouse Jundm2. Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 19 kDa
• Gene Name: Jun dimerization protein 2
• Database Link:
  NP_112149
  Entrez Gene 81703 Mouse
  UniProt ID P97875
• Background: Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin.
• Synonyms: JUNDM2
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Rabbit: 92%