Jdp2 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Mouse |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the n terminal of mouse Jundm2. Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 19 kDa |
Gene Name | Jun dimerization protein 2 |
Database Link | |
Background | Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin. |
Synonyms | JUNDM2 |
Note | Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Rabbit: 92% |
Reference Data |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.