Jdp2 Rabbit Polyclonal Antibody

SKU
TA329960
Rabbit Polyclonal Anti-Jundm2 Antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Jundm2 antibody: synthetic peptide directed towards the n terminal of mouse Jundm2. Synthetic peptide located within the following region: MMPGQIPDPSVTAGSLPGLGPLTGLPSSALTTEELKYADIRNIGAMIAPL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 19 kDa
Gene Name Jun dimerization protein 2
Database Link
Background Jundm2 is a component of the AP-1 transcription factor that represses transactivation mediated by the Jun family of proteins. Jundm2 is involved in a variety of transcriptional responses associated with AP-1, such as UV-induced apoptosis, cell differentiation, tumorigenesis and antitumogeneris.Jundm2 can also function as a repressor by recruiting histone deacetylase 3/HDAC3 to the promoter region of JUN.Jundm2 may control transcription via direct regulation of the modification of histones and the assembly of chromatin.
Synonyms JUNDM2
Note Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 92%; Rabbit: 92%
Reference Data
Write Your Own Review
You're reviewing:Jdp2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.