Nr5a2 Rabbit Polyclonal Antibody

SKU TA329959

Rabbit Polyclonal Anti-Nr5a2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Nr5a2 antibody: synthetic peptide directed towards the middle region of human Nr5a2. Synthetic peptide located within the following region: PQLVVNTPLQGQITSTQVTNQHLLRESNVISAQGPKPMRSSQLLPASGRS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 64 kDa
• Gene Name: nuclear receptor subfamily 5, group A, member 2
• Database Link:
  NP_109601
  P45448
• Background: Nr5a2 binds to promoters containing the sequence element 5'-AACGACCGACCTTGAG-3'. Nr5a2 plays a role in the regulation of gene expression in liver and pancreas. Nr5a2 may play a role in embryonic development.
• Synonyms: B1F; B1F2; CPF; FTF; FTZ-F1; FTZ-F1beta; hB1F; hB1F-2; LRH-1; LRH1
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 92%; Pig: 85%; Human: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%

Reference Data