Isl2 Rabbit Polyclonal Antibody

SKU TA329942

Rabbit Polyclonal Anti-ISL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ISL2 antibody: synthetic peptide directed towards the C terminal of mouse ISL2. Synthetic peptide located within the following region: VIRVWFQNKRCKDKKKSILMKQLQQQQHSDKASFQGLTGTPLVAGSPIGH
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 39 kDa
• Gene Name: insulin related protein 2 (islet 2)
• Database Link:
  NP_081673
  Q9CXV0
• Background: Isl2 specifies RGC laterality by repressing an ipsilateral pathfinding program unique to VTC RGCs and involving Zic2 and EphB1. This genetic hierarchy controls binocular vision.
• Synonyms: FLJ10160; Islet-2
• Note: Immunogen sequence homology: Rat: 93%; Mouse: 93%; Pig: 86%; Human: 86%; Rabbit: 86%; Guinea pig: 86%; Dog: 79%; Horse: 79%; Bovine: 79%

Reference Data