Tsc22d4 Rabbit Polyclonal Antibody

SKU TA329927

Rabbit Polyclonal Anti-Tsc22d4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Tsc22d4 antibody: synthetic peptide directed towards the middle region of mouse Tsc22d4. Synthetic peptide located within the following region: VAPAETGKVPPTDSRPNSPALYFDASLVHKSPDPFGAAAAQSLSLARSML
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 40 kDa
• Gene Name: TSC22 domain family, member 4
• Database Link:
  NP_076399
  Q9EQN3
• Background: Tsc22d4 may be a transcriptional repressor.
• Synonyms: THG-1; THG1; TILZ2; TSC-22-like
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 90%; Human: 90%; Bovine: 90%; Rabbit: 90%; Guinea pig: 90%

Reference Data