Tsg101 Rabbit Polyclonal Antibody

SKU TA329920

Rabbit Polyclonal Anti-TSG101 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TSG101 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RSELLELIQIMIVIFGEEPPVFSRPTVSASYPPYTATGPPNTSYMPGMPS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 43 kDa
• Gene Name: tumor susceptibility gene 101
• Database Link:
  NP_068684
  Q61187
• Background: TSG101 has a direct role in the control of growth and differentiation in primary epithelial cells. It is required for normal cell function of embryonic and adult tissues but that this gene is not a tumor suppressor for sporadic forms of breast cancer.
• Synonyms: TSG10; VPS23
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Pig: 93%; Goat: 93%; Bovine: 93%; Guinea pig: 93%; Dog: 86%; Horse: 79%; Human: 79%; Rabbit: 79%

Reference Data