MSL2L1 (MSL2) Rabbit Polyclonal Antibody

SKU TA329876

Rabbit Polyclonal Anti-MSL2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MSL2L1 antibody: synthetic peptide directed towards the N terminal of human MSL2L1. Synthetic peptide located within the following region: NPVNATALYISASRLVLNYDPGDPKAFTEINRLLPYFRQSLSCCVCGHLL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 62 kDa
• Gene Name: male-specific lethal 2 homolog (Drosophila)
• Database Link:
  NP_060603
  Q9HCI7
• Background: MSL2L1 is the component of histone acetyltransferase complex responsible for the majority of histone H4 acetylation at lysine 16 which is implicated in the formation of higher-order chromatin structure.
• Synonyms: MSL-2; MSL2L1; RNF184
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome