HERC5 Rabbit Polyclonal Antibody

SKU TA329858

Rabbit Polyclonal Anti-HERC5 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HERC5 antibody: synthetic peptide directed towards the N terminal of human HERC5. Synthetic peptide located within the following region: CLVAELVGYRVTQIACGRWHTLAYVSDLGKVFSFGSGKDGQLGNGGTRDQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 117 kDa
• Gene Name: HECT and RLD domain containing E3 ubiquitin protein ligase 5
• Database Link:
  NP_057407
  Q9UII4
• Background: HERC5 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates.This gene is a member of the HERC family of ubiquitin ligases and encodes a protein with a HECT domain and five RCC1 repeats. Pro-inflammatory cytokines upregulate expression of this gene in endothelial cells. The protein localizes to the cytoplasm and perinuclear region and functions as an interferon-induced E3 protein ligase that mediates ISGylation of protein targets. The gene lies in a cluster of HERC family genes on chromosome 4.
• Synonyms: CEB1; CEBP1
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Dog: 79%

Reference Data

• Protein Families: Druggable Genome