RNF160 (LTN1) Rabbit Polyclonal Antibody

SKU TA329857

Rabbit Polyclonal Anti-LTN1 Antibody

Product Data

• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZNF294 antibody: synthetic peptide directed towards the N terminal of human ZNF294. Synthetic peptide located within the following region: MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 200 kDa
• Gene Name: listerin E3 ubiquitin protein ligase 1
• Database Link:
  NP_056380
  O94822
• Background: ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.
• Synonyms: C21orf10; C21orf98; RNF160; ZNF294
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%

Reference Data