Sphingomyelin Synthase 1 (SGMS1) Rabbit Polyclonal Antibody

SKU TA329765

Rabbit polyclonal Anti-SGMS1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SGMS1 antibody: synthetic peptide directed towards the middle region of human SGMS1. Synthetic peptide located within the following region: SCFVLTTVMISVVHERVPPKEVQPPLPDTFFDHFNRVQWAFSICEINGMI
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 48 kDa
• Gene Name: sphingomyelin synthase 1
• Database Link:
  NP_671512
  Q86VZ5
• Background: SGMS1 is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain.The protein encoded by this gene is predicted to be a five-pass transmembrane protein. This gene may be predominately expressed in brain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: hmob33; MOB; MOB1; SMS1; TMEM23
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 77%

Reference Data

• Protein Families: Transmembrane
• Protein Pathways: Metabolic pathways, Sphingolipid metabolism