v Myb (MYBL1) Rabbit Polyclonal Antibody

SKU TA329755

Rabbit Polyclonal Anti-MYBL1 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-MYBL1 antibody: synthetic peptide directed towards the middle region of human MYBL1. Synthetic peptide located within the following region: AFIQQPFIDEDPDKEKKIKELEMLLMSAENEVRRKRIPSQPGSFSSWSGS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 82 kDa
• Gene Name: MYB proto-oncogene like 1
• Database Link:
  NP_001073885
  P10243
• Background: MYBL1 is a strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. MYBL1 could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
• Synonyms: A-MYB; AMYB
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Human: 100%; Rat: 92%; Horse: 92%; Mouse: 92%; Bovine: 92%; Rabbit: 92%; Guinea pig: 92%

Reference Data