TBX10 Rabbit Polyclonal Antibody

SKU TA329732

Rabbit Polyclonal Anti-TBX10 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TBX10 antibody: synthetic peptide directed towards the N terminal of human TBX10. Synthetic peptide located within the following region: TSSTGAQAVAEPTGQGPKNPRVSRVTVQLEMKPLWEEFNQLGTEMIVTKA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: T-box 10
• Database Link:
  NP_005986
  O75333
• Background: TBX10, a member of the Tbx1-subfamily of conserved developmental genes, is located at human chromosome 11q13 and proximal mouse chromosome 19.
• Synonyms: TBX7; TBX13
• Note: Immunogen sequence homology: Human: 100%; Horse: 93%; Mouse: 93%; Rat: 92%; Pig: 86%; Bovine: 86%

Reference Data