BARHL2 Rabbit Polyclonal Antibody

CAT#: TA329727

Rabbit Polyclonal Anti-BARHL2 Antibody

Product Images

WB Suggested Anti-BARHL2 Antibody Titration: 0.05-2.0ug/ml; Positive Control: HepG2 cell lysate

• 

  Human Lung

• 

  Human kidney

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-BARHL2 antibody: synthetic peptide directed towards the middle region of human BARHL2. Synthetic peptide located within the following region: SSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEG
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 42 kDa
• Gene Name: BarH like homeobox 2
• Database Link:
  NP_064447
  Entrez Gene 343472 Human
  UniProt ID Q9NY43
• Background: BARHL2 and BARHL1 are two homeobox genes in mouse and human, which are highly related to the Bar Drosophila genes.
• Synonyms: BarH-like 2; BarH-like homeobox 2; OTTHUMP00000011704
• Note: Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%; Dog: 86%; Bovine: 86%; Zebrafish: 77%