TFAP2E Rabbit Polyclonal Antibody

SKU TA329723

Rabbit Polyclonal Anti-TFAP2E Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-TFAP2E antibody: synthetic peptide directed towards the N terminal of human TFAP2E. Synthetic peptide located within the following region: MLVHTYSAMERPDGLGAAAGGARLSSLPQAAYGPAPPLCHTPAATAAAEF
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: transcription factor AP-2 epsilon
• Database Link:
  NP_848643
  Q6VUC0
• Background: TFAP2E is the sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC. AP-2 epsilon may play a role in the development of the CNS and in cartilage differentiation
• Synonyms: AP2E
• Note: Immunogen sequence homology: Human: 100%; Bovine: 100%; Mouse: 92%

Reference Data

• Protein Families: Transcription Factors