HCLS1 Rabbit Polyclonal Antibody

SKU TA329699

Rabbit Polyclonal Anti-HCLS1 Antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-HCLS1 antibody: synthetic peptide directed towards the N terminal of human HCLS1. Synthetic peptide located within the following region: VNDISEKEQRWGAKTIEGSGRTEHINIHQLRNKVSEEHDVLRKKEMESGP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 54 kDa
• Gene Name: hematopoietic cell-specific Lyn substrate 1
• Database Link:
  NP_005326
  P14317
• Background: HCLS1 is a substrate for caspase cleavage during apoptosis.
• Synonyms: CTTNL; HS1; lckBP1; p75
• Note: Immunogen sequence homology: Human: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Horse: 86%; Mouse: 86%; Bovine: 86%; Rabbit: 86%; Guinea pig: 86%

Reference Data

• Protein Families: Transcription Factors
• Protein Pathways: Pathogenic Escherichia coli infection, Tight junction