GTF3C2 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-GTF3C2 antibody: synthetic peptide directed towards the middle region of human GTF3C2. Synthetic peptide located within the following region: YKADLIPYQDSPEGPDHSSASSGVPNPPKARTYTETVNHHYLLFQDTDLG |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 101 kDa |
Gene Name | general transcription factor IIIC subunit 2 |
Database Link | |
Background | GTF3C2 is required for RNA polymerase III-mediated transcription. GTF3C2 is a component of TFIIIC that initiates transcription complex assembly on tRNA and is required for transcription of 5S rRNA and other stable nuclear and cytoplasmic RNAs. GTF3C2 may play a direct role in stabilizing interactions of TFIIIC2 with TFIIIC1. |
Synonyms | TFIIIC-BETA; TFIIIC110 |
Note | Immunogen sequence homology: Human: 100%; Dog: 92%; Horse: 92%; Pig: 85%; Rat: 85%; Bovine: 85%; Rabbit: 85%; Guinea pig: 85%; Mouse: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.