Foxn2 Rabbit Polyclonal Antibody

SKU
TA329631
Rabbit polyclonal anti-Foxn2 antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Mouse
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-Foxn2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGPVIGMTPDKRAETPGAEKVAGLSQIYKMGSLPEAGDAARPKATLVGSE
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 23 kDa
Gene Name forkhead box N2
Database Link
Background The function of this protein remains unknown.
Synonyms HTLF
Note Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Mouse: 100%; Bovine: 100%; Pig: 92%; Human: 92%; Rabbit: 92%; Guinea pig: 85%
Reference Data
Write Your Own Review
You're reviewing:Foxn2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.