Cbfa2t2 Rabbit Polyclonal Antibody

SKU TA329599

Rabbit polyclonal anti-Cbfa2t2 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Cbfa2t2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: AVLRRCQESDREELNYWKRRFNENTELRKTGTELVSRQHSPGSTDSLSND
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 66 kDa
• Gene Name: core-binding factor, runt domain, alpha subunit 2, translocated to, 2 (human)
• Database Link:
  NP_766448
  O70374
• Background: Cbfa2t2 may be a transcriptional corepressor.
• Synonyms: DKFZp313F2116; EHT; MTGR1; OTTHUMP00000030653; p85; ZMYND3
• Note: Immunogen sequence homology: Rat: 100%; Mouse: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Human: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 92%

Reference Data