Dmrt2 Rabbit Polyclonal Antibody

SKU TA329587

Rabbit polyclonal anti-DMRT2 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-DMRT2 antibody: synthetic peptide directed towards the C terminal of mouse DMRT2. Synthetic peptide located within the following region: RPSLPLKTNPFHSVFQQTLSDKSGPELNAPFVKEAFEETPKKHRECLVKE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 37 kDa
• Gene Name: doublesex and mab-3 related transcription factor 2
• Database Link:
  NP_665830
  Q8BG36
• Background: DMRT2 is a protein disclosed by NIH MGC program
• Synonyms: DSXL-2; DSXL2; OTTHUMP00000020964; OTTHUMP00000020966; OTTHUMP00000020967
• Note: Immunogen sequence homology: Mouse: 100%; Dog: 86%; Pig: 86%; Rat: 86%; Human: 86%; Rabbit: 86%; Guinea pig: 86%; Bovine: 79%

Reference Data