ART5 Rabbit Polyclonal Antibody

SKU TA329570

Rabbit polyclonal anti-ART5 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ART5 antibody: synthetic peptide directed towards the middle region of human ART5. Synthetic peptide located within the following region: VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 30 kDa
• Gene Name: ADP-ribosyltransferase 5
• Database Link:
  NP_001073004
  Q96L15
• Background: The specific function of the protein remains unknown. The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.
• Synonyms: ARTC5
• Note: Immunogen sequence homology: Horse: 100%; Human: 100%; Dog: 93%; Rabbit: 93%; Rat: 86%; Mouse: 86%; Pig: 79%

Reference Data

• Protein Families: Secreted Protein