Rgs1 Rabbit Polyclonal Antibody

SKU TA329544

Rabbit Polyclonal anti-Rgs1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Rgs1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MRAAAISMPRLNKMPGMFFSASPKDSKEHSHSLLDDKKQKKRPKTFGMDV
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 23 kDa
• Gene Name: regulator of G-protein signaling 1
• Database Link:
  NP_056626
  Q9JL25
• Background: Rgs1 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form.
• Synonyms: 1R20; BL34; IER1; IR20
• Note: Immunogen sequence homology: Mouse: 100%; Rat: 93%; Bovine: 93%; Rabbit: 93%; Dog: 86%; Horse: 86%; Human: 86%; Pig: 79%

Reference Data