Gja10 Rabbit Polyclonal Antibody

SKU TA329543

Rabbit Polyclonal anti-Gja10 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-Gja10 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: MGDWNLLGGILEEVHSHSTIVGKIWLTILFIFRMLVLGVAAEDVWDDEQS
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 57 kDa
• Gene Name: gap junction protein, alpha 10
• Database Link:
  NP_034419
  Q9WUS4
• Background: One gap junction consists of a cluster of closely packed pairs of transmembrane channels, the connexons, through which materials of low MW diffuse from one cell to a neighboring cell.Gja10 is ivolved in tracer coupling between horizontal cells of the retina.Gja10 may play a role in the regulation of horizontal cell patterning.
• Synonyms: Connexin-62; CX62; RP11-63K6.6
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 86%

Reference Data