Rapgef2 Rabbit Polyclonal Antibody

SKU TA329531

Rabbit Polyclonal Anti-Rapgef2 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Rapgef2 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Rapgef2. Synthetic peptide located within the following region: GHTHFDYSGDAASIWASGGHMDQMMFSDHSTKYNRQNQSRESLEQAQSRA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 164 kDa
• Gene Name: Rap guanine nucleotide exchange factor (GEF) 2
• Database Link:
  NP_001093094
• Background: Rapgef2 is a Guanine nucleotide exchange factor (GEF) for Rap1, Rap1B and Rap2 GTPases.
• Synonyms: CNrasGEF; DKFZP586O1422; KIAA0313; NRAPGEP; PDZ-GEF1; PDZGEF1; RA(Ras/Rap1A-associating)-GEF; RA-GEF; Rap-GEP
• Note: Immunogen sequence homology: Dog: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Pig: 93%; Bovine: 79%

Reference Data