SLC44A4 Rabbit Polyclonal Antibody

SKU TA329498

Rabbit Polyclonal Anti-SLC44A4 Antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-SLC44A4 antibody is: synthetic peptide directed towards the middle region of Human SLC44A4. Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 78 kDa
• Gene Name: solute carrier family 44 member 4
• Database Link:
  NP_001171515
  Q53GD3
• Background: The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
• Synonyms: C6orf29; CTL4; NG22; TPPT
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Horse: 93%; Mouse: 93%; Bovine: 92%; Zebrafish: 85%

Reference Data

• Protein Families: Transmembrane