C5ORF4 (FAXDC2) Rabbit Polyclonal Antibody

SKU TA329495

Rabbit Polyclonal anti-C5orf4 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-C5orf4 antibody: synthetic peptide directed towards the N terminal of human C5orf4. Synthetic peptide located within the following region: MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 21 kDa
• Gene Name: fatty acid hydroxylase domain containing 2
• Database Link:
  NP_115761
  Q96IV6
• Background: The function remains unknown.
• Synonyms: C5orf4
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 93%; Rat: 92%; Guinea pig: 92%

Reference Data

• Protein Families: Transmembrane