ZDHHC16 Rabbit Polyclonal Antibody

SKU TA329494

Rabbit Polyclonal anti-ZDHHC18 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZDHHC18 antibody: synthetic peptide directed towards the middle region of human ZDHHC18. Synthetic peptide located within the following region: FSIWSILGLSGFHTYLVASNLTTNEDIKGSWSSKRGGEASVNPYSHKSII
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 42 kDa
• Gene Name: zinc finger DHHC-type containing 16
• Database Link:
  NP_932160
  Q969W1
• Background: ZDHHC18 has palmitoyltransferase activity towards HRAS and LCK.
• Synonyms: APH2; DHHC-16
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Transmembrane