TPTE Rabbit Polyclonal Antibody

SKU
TA329483
Rabbit Polyclonal anti-TRABD antibody
$585.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-TRABD antibody: synthetic peptide directed towards the middle region of human TRABD. Synthetic peptide located within the following region: LCFLSDPISKDDVERCKQKDLLEQMMAEMIGEFPDLHRTIVSERDVYLTY
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 42 kDa
Gene Name transmembrane phosphatase with tensin homology
Database Link
Background The function of TRABD remains unknown.
Synonyms CT44; PTEN2
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data
Protein Families Druggable Genome, Transmembrane
Write Your Own Review
You're reviewing:TPTE Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.