GFI1 Rabbit Polyclonal Antibody

SKU TA329432

Rabbit Polyclonal anti-GFI1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human, Mouse
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GFI1 antibody: synthetic peptide directed towards the N terminal of human GFI1. Synthetic peptide located within the following region: MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: growth factor independent 1 transcriptional repressor
• Database Link:
  NP_005254
  Q99684
• Background: GFI1 may be a transcription factor involved in regulating the expression of genes active in the S phase during cell cycle progression in T-cells. GFI1 may be involved in tumor progression. Defects in GFI1 are a cause of autosomal dominant severe congenital neutropenia (SCN) and dominant nonimmune chronic idiopathic neutropenia of adults (NI-CINA)
• Synonyms: GFI-1; GFI1A; SCN2; ZNF163
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors