AATF Rabbit Polyclonal Antibody

SKU TA329431

Rabbit Polyclonal anti-AATF antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-AATF antibody: synthetic peptide directed towards the N terminal of human AATF. Synthetic peptide located within the following region: EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: apoptosis antagonizing transcription factor
• Database Link:
  NP_036270
  Q9NY61
• Background: The AATF gene encodes a protein that was identified on the basis of its interaction with MAP3K12/DLK, a protein kinase known to be involved in the induction of cell apoptosis. This gene product contains a leucine zipper, which is a characteristic motif of transcription factors, and was shown to exhibit strong transactivation activity when fused to Gal4 DNA binding domain. Overexpression of this gene interfered with MAP3K12 induced apoptosis.
• Synonyms: BFR2; CHE-1; CHE1; DED
• Note: Immunogen sequence homology: Human: 100%; Rabbit: 100%; Rat: 90%; Yeast: 90%; Horse: 85%; Dog: 77%; Mouse: 77%

Reference Data

• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors