ZNF620 Rabbit Polyclonal Antibody

SKU
TA329413
Rabbit Polyclonal anti-ZNF620 antibody
$525.00
5 Days*
Specifications
Product Data
Application WB
Recommended Dilution WB
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-ZNF620 antibody: synthetic peptide directed towards the middle region of human ZNF620. Synthetic peptide located within the following region: TVHQRMHTGEKPYECKECGKRLSSNTALTQHQRIHTGEKPFECKECGKAF
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 49 kDa
Gene Name zinc finger protein 620
Database Link
Background ZNF620 is a new candidate transcription factor
Synonyms MGC50836
Note Immunogen sequence homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%
Reference Data
Write Your Own Review
You're reviewing:ZNF620 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.