ZKSCAN5 Rabbit Polyclonal Antibody
Product Data | |
Application | WB |
---|---|
Recommended Dilution | WB |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ZFP95 antibody: synthetic peptide directed towards the N terminal of human ZFP95. Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 97 kDa |
Gene Name | zinc finger with KRAB and SCAN domains 5 |
Database Link | |
Background | ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis. |
Synonyms | ZFP95; ZNF914; ZSCAN37 |
Note | Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Guinea pig: 86%; Mouse: 79% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.