ZKSCAN5 Rabbit Polyclonal Antibody

SKU TA329411

Rabbit Polyclonal anti-ZFP95 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ZFP95 antibody: synthetic peptide directed towards the N terminal of human ZFP95. Synthetic peptide located within the following region: MIMTESREVIDLDPPAETSQEQEDLFIVKVEEEDCTWMQEYNPPTFETFY
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 97 kDa
• Gene Name: zinc finger with KRAB and SCAN domains 5
• Database Link:
  NP_659570
  Q9Y2L8
• Background: ZFP95 is a zinc finger protein of the Kruppel family. It contains a SCAN box and a KRAB A domain. A similar protein in mouse is differentially expressed in spermatogenesis.
• Synonyms: ZFP95; ZNF914; ZSCAN37
• Note: Immunogen sequence homology: Pig: 100%; Human: 100%; Dog: 92%; Horse: 92%; Guinea pig: 86%; Mouse: 79%

Reference Data

• Protein Families: Transcription Factors