HIC2 Rabbit Polyclonal Antibody
Product Data | |
Application | IF, WB |
---|---|
Recommended Dilution | WB, IF |
Reactivity | Human |
Antibody Host | Rabbit |
Isotype | IgG |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC |
Buffer | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Conjugation | Unconjugated |
Storage | Store at -20°C as received. |
Stability | Stable for 12 months from date of receipt. |
Shipping | Blue Ice |
Predicted Protein Size | 66 kDa |
Gene Name | hypermethylated in cancer 2 |
Database Link | |
Background | HIC2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor. |
Synonyms | HRG22; ZBTB30; ZNF907 |
Note | Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 77% |
Reference Data | |
Protein Families | Transcription Factors |
Write Your Own Review
Product Manuals |
FAQs |
SDS |
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.