HIC2 Rabbit Polyclonal Antibody

SKU
TA329406
Rabbit Polyclonal anti-HIC2 antibody
$585.00
5 Days*
Specifications
Product Data
Application IF, WB
Recommended Dilution WB, IF
Reactivity Human
Antibody Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-HIC2 antibody: synthetic peptide directed towards the middle region of human HIC2. Synthetic peptide located within the following region: CKEEEENGKDASEDSAQSGSEGGSGHASAHYMYRQEGYETVSYGDNLYVC
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Shipping Blue Ice
Predicted Protein Size 66 kDa
Gene Name hypermethylated in cancer 2
Database Link
Background HIC2 contains 5 C2H2-type zinc fingers and 1 BTB (POZ) domain. It belongs to the krueppel C2H2-type zinc-finger protein family, Hic subfamily and is a transcriptional repressor.
Synonyms HRG22; ZBTB30; ZNF907
Note Immunogen sequence homology: Human: 100%; Dog: 85%; Pig: 85%; Rat: 85%; Horse: 85%; Mouse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 77%
Reference Data
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:HIC2 Rabbit Polyclonal Antibody
Your Rating

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.