FOXL1 Rabbit Polyclonal Antibody

SKU TA329391

Rabbit Polyclonal anti-FOXL1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FOXL1 antibody: synthetic peptide directed towards the N terminal of human FOXL1. Synthetic peptide located within the following region: SHLFDPRLPALAASPMLYLYGPERPGLPLAFAPAAALAASGRAETPQKPP
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 36 kDa
• Gene Name: forkhead box L1
• Database Link:
  NP_005241
  Q12952
• Background: The exact function of FOXL1 remains unknown.
• Synonyms: FKH6; FKHL11; FREAC7
• Note: Immunogen sequence homology: Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Dog: 92%; Bovine: 85%

Reference Data

• Protein Families: Transcription Factors