Gsh1 (GSX1) Rabbit Polyclonal Antibody

SKU TA329378

Rabbit Polyclonal anti-GSX1 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-GSX1 antibody: synthetic peptide directed towards the N terminal of human GSX1. Synthetic peptide located within the following region: MPRSFLVDSLVLREAGEKKAPEGSPPPLFPYAVPPPHALHGLSPGACHAR
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 28 kDa
• Gene Name: GS homeobox 1
• Database Link:
  NP_663632
  Q9H4S2
• Background: GSX1 is a probable transcription factor that binds to the DNA sequence 5'-GC[TA][AC]ATTA[GA]-3'. GSX1 activates the transcription of the GHRH gene. GSX1 plays an important role in pituitary development.
• Synonyms: Gsh-1; GSH1
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Horse: 93%

Reference Data

• Protein Families: Transcription Factors