EVI1 (MECOM) Rabbit Polyclonal Antibody

SKU TA329377

Rabbit Polyclonal anti-EVI1 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-EVI1 antibody: synthetic peptide directed towards the C terminal of human EVI1. Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 118 kDa
• Gene Name: MDS1 and EVI1 complex locus
• Database Link:
  NP_005232
  Q03112
• Background: EVI1 promotes cell proliferation by interacting with BRG1 and blocking the repression of BRG1 on E2F1 activity.
• Synonyms: AML1-EVI-1; EVI1; MDS1; MDS1-EVI1; PRDM3
• Note: Immunogen sequence homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Chronic myeloid leukemia, MAPK signaling pathway, Pathways in cancer