LASS3 (CERS3) Rabbit Polyclonal Antibody

SKU TA329371

Rabbit Polyclonal anti-LASS3 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-LASS3 antibody: synthetic peptide directed towards the N terminal of human LASS3. Synthetic peptide located within the following region: RVFEKFVASPLAKSFGIKETVRKVTPNTVLENFFKHSTRQPLQTDIYGLA
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 46 kDa
• Gene Name: ceramide synthase 3
• Database Link:
  NP_849164
  Q8IU89
• Background: The gene encoding the hypothetical protein LASS3 is located on chromosome 15.
• Synonyms: ARCI9; LASS3
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 92%; Bovine: 92%; Guinea pig: 92%; Horse: 85%; Mouse: 85%; Rat: 77%; Rabbit: 77%

Reference Data

• Protein Families: Transcription Factors, Transmembrane