SLC34A3 Rabbit Polyclonal Antibody

SKU TA329337

Rabbit Polyclonal anti-SLC34A3 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SLC34A3 antibody: synthetic peptide directed towards the middle region of human SLC34A3. Synthetic peptide located within the following region: GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 63 kDa
• Gene Name: solute carrier family 34 member 3
• Database Link:
  NP_543153
  Q8N130
• Background: SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney.SLC34A3 contributes to the maintenance of inorganic phosphate (Pi) concentration at the kidney (Segawa et al., 2002 [PubMed 11880379]). [supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-942 AK095999.1 1-942 943-2142 AB055000.1 827-2026
• Synonyms: HHRH; NPTIIc
• Note: Immunogen sequence homology: Human: 100%; Mouse: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Horse: 86%; Bovine: 86%

Reference Data

• Protein Families: Transmembrane