ERCC8 Rabbit Polyclonal Antibody

SKU TA329326

Rabbit Polyclonal anti-ERCC8 antibody

Product Data

• Application: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-ERCC8 antibody: synthetic peptide directed towards the C terminal of human ERCC8. Synthetic peptide located within the following region: QELYSGSRDCNILAWVPSLYEPVPDDDETTTKSQLNPAFEDAWSSSDEEG
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 44 kDa
• Gene Name: ERCC excision repair 8, CSA ubiquitin ligase complex subunit
• Database Link:
  NP_000073
  Q13216
• Background: ERCC8 (excision repair cross-complementing rodent repair deficiency, complementation group 8 isoform 1) is a WD repeat protein, which interacts with Cockayne syndrome type B (CSB) protein and with p44 protein, a subunit of the RNA polymerase II transcript
• Synonyms: CKN1; CSA; UVSS2
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Horse: 86%; Pig: 79%; Rat: 79%; Rabbit: 79%

Reference Data

• Protein Families: Druggable Genome, Transcription Factors
• Protein Pathways: Nucleotide excision repair, Ubiquitin mediated proteolysis