OSR2 Rabbit Polyclonal Antibody

SKU TA329324

Rabbit Polyclonal anti-OSR2 antibody

Product Data

• Application: WB
• Recommended Dilution: WB
• Reactivity: Human
• Antibody Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-OSR2 antibody: synthetic peptide directed towards the N terminal of human OSR2. Synthetic peptide located within the following region: YSFLQAVNTFPATVDHLQGLYGLSAVQTMHMNHWTLGYPNVHEITRSTIT
• Buffer: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.; Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Shipping: Blue Ice
• Predicted Protein Size: 31 kDa
• Gene Name: odd-skipped related transciption factor 2
• Database Link:
  NP_443727
  Q8N2R0
• Background: Osr2 is a zinc finger containing protein related to Drosophila Odd-skipped. Its mRNA expression is specifically activated in the nascent palatal mesenchyme at the onset of palatal outgrowth. Osr2 mutants exhibit altered gene expression patterns, including those of Osr1, Pax9 and Tgfb3, during palate development.
• Synonyms: FLJ90037
• Note: Immunogen sequence homology: Human: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Guinea pig: 93%

Reference Data